"action" : "pulsate" { "action" : "rerender" ] "disableLinks" : "false", ', 'ajax'); { } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "action" : "rerender" }, { // --> // If watching, pay attention to key presses, looking for right sequence. $('#custom-overall-notif-count').html(notifCount); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "useSubjectIcons" : "true", "event" : "ProductAnswerComment", }, "showCountOnly" : "false", watching = false; { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1408164,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ "action" : "rerender" "action" : "rerender" "action" : "rerender" "action" : "rerender" "context" : "", "entity" : "1408164", "event" : "removeMessageUserEmailSubscription", { ] } "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"t68kxMZhZpK-mn7n4NHdWkE3hTc-pwW60kNwOvRlI_U. "initiatorDataMatcher" : "data-lia-message-uid" { { { ] "context" : "", ] { "closeEvent" : "LITHIUM:lightboxCloseEvent", "context" : "", } LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); } "context" : "envParam:quiltName,product,contextId,contextUrl", { { $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); // console.log('watching: ' + key); // Oops, not the right sequence, lets restart from the top. var keycodes = { "initiatorBinding" : true, "event" : "ProductAnswerComment", }); "event" : "MessagesWidgetEditAnswerForm", "context" : "", }); // just for convenience, you need a login anyways... /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } { "action" : "rerender" { ] "event" : "MessagesWidgetMessageEdit", "action" : "rerender" ] "action" : "rerender" "useSubjectIcons" : "true", "actions" : [ { "kudosLinksDisabled" : "false", "event" : "ProductMessageEdit", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "markAsSpamWithoutRedirect", count = 0; notifCount = parseInt($(this).html()) + notifCount; "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "event" : "unapproveMessage", "context" : "", }, ] "initiatorDataMatcher" : "data-lia-message-uid" } { { window.onload = function() { ;(function($) { .attr('aria-selected','false'); { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'zGjJFrmdCqQ0b3Pl24JDVk0fIZNpJ4Z2ssAuxZogrE0. } { "parameters" : { } "disableKudosForAnonUser" : "false", "useSimpleView" : "false", }); }); } "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", { { { "actions" : [ "parameters" : { "}); "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], "actions" : [ "actions" : [ "event" : "MessagesWidgetAnswerForm", }); }, "actions" : [ }, "actions" : [ "context" : "", NAT-Typ am PC ändern. LITHIUM.Loader.runJsAttached(); $(this).toggleClass("view-btn-open view-btn-close"); ] }, "actions" : [ "event" : "addThreadUserEmailSubscription", "event" : "RevokeSolutionAction", "actions" : [ "disableKudosForAnonUser" : "false", "context" : "", // --> ] "message" : "1391963", Private Daten erfragen wir bei Bedarf. count++; "context" : "", "selector" : "#kudosButtonV2_0", "showCountOnly" : "false", }, "action" : "rerender" "initiatorBinding" : true, "componentId" : "forums.widget.message-view", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { { "showCountOnly" : "false", "actions" : [ { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", count = 0; } } "context" : "", ] "event" : "deleteMessage", "includeRepliesModerationState" : "false", ] "event" : "kudoEntity", { "message" : "1408164", CookieManager = { { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { ] "context" : "", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/48328","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Mo02RWV5nbb8VbN8tIx-CJLQ3a_19X6mrj0X9GuemIg. "eventActions" : [ "action" : "rerender" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_66acec73521247_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/48328&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "actions" : [ "actions" : [ var expireDate = new Date(); }, "context" : "envParam:quiltName", } "context" : "envParam:entity", }, ] "eventActions" : [ "context" : "", { { ] } } "entity" : "1408164", { } } { LITHIUM.Loader.runJsAttached(); //$('#lia-body').addClass('lia-window-scroll'); { LITHIUM.Dialog({ { "componentId" : "forums.widget.message-view", { "actions" : [ { ', 'ajax'); "context" : "", "defaultAriaLabel" : "", "parameters" : { LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] { "truncateBodyRetainsHtml" : "false", "action" : "addClassName" })(LITHIUM.jQuery); }); ] } ] }, { ], }); { "truncateBody" : "true", ] } "actions" : [ "includeRepliesModerationState" : "false", "context" : "envParam:quiltName", { "event" : "MessagesWidgetMessageEdit", } "eventActions" : [ "selector" : "#kudosButtonV2_3", { "actions" : [ }, var element = $(this).parent('li'); "parameters" : { "actions" : [ "event" : "removeThreadUserEmailSubscription", LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_6f0de568f0e8b2","nodesModel":{"Endgeraete|category":{"title":"Kategorie-Suche: Archiv_Festnetz-und-LTE-Geräte","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Festnetz-und-LTE-Geräte","inputSelector":".lia-search-input-message"},"ArchivFestnetz-und-LTE-Geraete|forum-board":{"title":"Board-Suche: Archiv_Festnetz-und-LTE-Geräte","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_6f0de568f0e8b2_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); ] return; LITHIUM.AjaxSupport.ComponentEvents.set({ }, "disableLabelLinks" : "false", }); }, ] // We made it! } lithstudio: [], ] } }, "actions" : [ }, "action" : "rerender" ], ], "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "event" : "ProductAnswer", "action" : "rerender" }, "actions" : [ $('div[class*="-menu-btn"]').removeClass('active'); }, }, ] if ( key == neededkeys[0] ) { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivFestnetz-und-LTE-Geraete/thread-id/11780","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vqFo_Z9TVUut9Xx13AOkk7N8rRQ4e2nbdbufmWqdQwc. "action" : "rerender" } element.siblings('li').find('ul').slideUp(); { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; .attr('aria-expanded','false'); }, $(document).ready(function(){ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); if ( count == neededkeys.length ) { } "displayStyle" : "horizontal", "disallowZeroCount" : "false", } "kudosLinksDisabled" : "false", "initiatorBinding" : true, } { { }); if(do_scroll == "true"){ }, Check out our port forwarding guides for the Arris routers. ] } }, }, ] LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "kudosable" : "true", // console.log('watching: ' + key); { $(event.data.selector).removeClass('cssmenu-open'); "event" : "MessagesWidgetAnswerForm", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", "action" : "rerender" }, "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "AcceptSolutionAction", $('#node-menu li.active').children('ul').show(); ] ] "event" : "ProductMessageEdit", "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1392048,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. //resetMenu(); }); })(LITHIUM.jQuery); // Pull in global jQuery reference }, "action" : "pulsate" { ] "context" : "", "componentId" : "forums.widget.message-view", "action" : "pulsate" }, "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "activecastFullscreen" : false, "context" : "", "action" : "rerender" "defaultAriaLabel" : "", "event" : "ProductMessageEdit", element.find('ul').slideUp(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "action" : "rerender" })(LITHIUM.jQuery); }, "useTruncatedSubject" : "true", "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); createStorage("false"); "useCountToKudo" : "false", "action" : "rerender" "context" : "", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", ] LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "event" : "MessagesWidgetAnswerForm", })(LITHIUM.jQuery); "displayStyle" : "horizontal", "useSubjectIcons" : "true", "action" : "rerender" ] ] "message" : "207184", { "action" : "rerender" //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} ] { } "event" : "AcceptSolutionAction", ] LITHIUM.AjaxSupport.ComponentEvents.set({ var key = e.keyCode; ] "initiatorBinding" : true, "event" : "addThreadUserEmailSubscription", "event" : "approveMessage", { }, "actions" : [ } // We're good so far. }, } LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_6f0de569a7dd3b', 'disableAutoComplete', '#ajaxfeedback_6f0de568f0e8b2_0', 'LITHIUM:ajaxError', {}, 'POALzOELBhvMbRb-DrjbFNNqAAnbrGs00ck95LbsWBA. "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message", "disableLabelLinks" : "false", }); .attr('aria-expanded','false'); "context" : "", "context" : "", ] "context" : "envParam:entity", } "action" : "addClassName" } "event" : "MessagesWidgetEditAnswerForm", } var watching = false; }, { $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); ] "componentId" : "kudos.widget.button", "event" : "QuickReply", } { })(LITHIUM.jQuery); "actions" : [ }, "useTruncatedSubject" : "true", "context" : "envParam:quiltName,expandedQuiltName", } Bist du sicher, dass du fortfahren möchtest? "defaultAriaLabel" : "", Danach erfolgen die Portfreigaben. "selector" : "#kudosButtonV2", } } "event" : "addThreadUserEmailSubscription", "eventActions" : [ "actions" : [ } }); "event" : "MessagesWidgetEditAction", "event" : "ProductAnswerComment", "action" : "rerender" { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "action" : "pulsate" "action" : "rerender" } LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); ] "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ resetMenu(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { ] $(this).toggleClass('active'); "linkDisabled" : "false" ] }, { "action" : "rerender" "context" : "envParam:quiltName,message", "event" : "QuickReply", "disableKudosForAnonUser" : "false", "actions" : [ "linkDisabled" : "false" }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "useSimpleView" : "false", }, }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "actions" : [ } "accessibility" : false, { "event" : "deleteMessage", { "useSimpleView" : "false", }, .attr('aria-hidden','false') "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "context" : "envParam:quiltName,message", "action" : "rerender" createStorage("false"); }, { "context" : "envParam:selectedMessage", "event" : "approveMessage", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ }, $('#community-menu-toggle').click(function() { else { } $('div[class*="-menu-btn"]').removeClass('active'); }; } ] }, "event" : "MessagesWidgetEditAnswerForm", "truncateBodyRetainsHtml" : "false", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ], // If watching, pay attention to key presses, looking for right sequence. { }, }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "actions" : [